General Information

  • ID:  hor000264
  • Uniprot ID:  A0A8C2T027(28-44)
  • Protein name:  Gastrin-releasing peptide
  • Gene name:  GRP
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  exhibit sex differences
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APLQPGGSPALTKIYPR
  • Length:  17(28-44)
  • Propeptide:  MGCGGPRRPGALPLLALLALLAAQGGAAPLQPGGSPALTKIYPRGSHWAVGHLMGKKSTGDIPYAYEEENKNPFSASPENVKQLDDYLQREEMSKHLLQLLEGNENKSAHFSKGELPWHTRNSGETDDSSSWKDYLLQAVNMKDSTPS
  • Signal peptide:  MGCGGPRRPGALPLLALLALLAAQGGA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000264_AF2.pdbhor000264_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 205164 Formula: C81H132N22O22
Absent amino acids: CDEFHMNVW Common amino acids: P
pI: 10.45 Basic residues: 2
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -36.47 Boman Index: -1186
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 80.59
Instability Index: 9351.18 Extinction Coefficient cystines: 1490
Absorbance 280nm: 93.13

Literature

  • PubMed ID:  20298575
  • Title:  Neuropeptidomic Analysis of the Embryonic Japanese Quail Diencephalon